PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2137100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-PHD
Protein Properties Length: 687aa    MW: 77821.3 Da    PI: 9.4846
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2137100.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.91.1e-10469516653
                      S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
         Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                      ++ ++ +e+L ++F++n  p ++ re L+k+lgL+ ++V+ WF+N R+
  Lj4g3v2137100.1 469 RIPHNAVERLRQVFAENELPPRSIRESLSKELGLEIQKVSKWFKNARY 516
                      5667889****************************************8 PP

2PHD37.65e-13218272251
                      BTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
              PHD   2 CkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                      C+ C+   +  ++ ++lCd +C+++fH+kC++++l+se++peg   wlC+ C +k
  Lj4g3v2137100.1 218 CAKCKLreDLPDNGIILCDgTCNRAFHQKCHDPPLDSEDIPEGdqGWLCKFCACK 272
                      8889885444599******56*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.40.107.8E-12210273IPR013083Zinc finger, RING/FYVE/PHD-type
SuperFamilySSF579038.06E-14212274IPR011011Zinc finger, FYVE/PHD-type
PROSITE profilePS5001610.149215272IPR019787Zinc finger, PHD-finger
SMARTSM002494.2E-9217270IPR001965Zinc finger, PHD-type
CDDcd155047.01E-28217269No hitNo description
PROSITE patternPS013590218269IPR019786Zinc finger, PHD-type, conserved site
PfamPF006281.7E-10218271IPR019787Zinc finger, PHD-finger
Gene3DG3DSA:1.10.10.601.1E-11454515IPR009057Homeodomain-like
SuperFamilySSF466892.22E-10460524IPR009057Homeodomain-like
PROSITE profilePS5007112.212461521IPR001356Homeobox domain
SMARTSM003891.6E-8463525IPR001356Homeobox domain
CDDcd000863.05E-8464516No hitNo description
PfamPF000463.2E-8469516IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MRYSDKKLNR GGPKKSGLLK ALKKCQGKKH KMKSRSRTNS VGTNISRKRV TDSSLKGPHK  60
DSSNKKLVSR QKLHKTDRKS SQKSSSKLQG KKVSLGSRKE GKDADGEVKL QKLKRRRKKK  120
RQKNNVDVDE ASRLQRRTRY LLIKMKLEQN LIDAYSGEGW KGQSREKIRP EKELQRARKQ  180
ILKCKLGIRD AIHQLDSLSS SSSIEDSVID PDHEHILCAK CKLREDLPDN GIILCDGTCN  240
RAFHQKCHDP PLDSEDIPEG DQGWLCKFCA CKMEILGAMN AHLGTRFSLH SDWQDVFKEE  300
ASLPDGDVAS LNPEAEWPSD DSEDDDYNPE RAEDSRNINT EESDHNASDD SSSSTSLCSS  360
DSECSPLDDG VNHEHFSVNS SVDSDESDEK ECGRRQRKAV DYKKLYDEMF GKDALACEQV  420
SEDEDWGECD AVDTLMTLHE SENKNPNNGH NSKTRGGSLG VNIRRPNFRI PHNAVERLRQ  480
VFAENELPPR SIRESLSKEL GLEIQKVSKW FKNARYTALK TRKLQAGSDQ LQNITSKSSR  540
LLNQEKADPL ESKTSLTITH SPKNVKNATD GKKIQPSSSP LQGTQRKLSS TQPRENGNKD  600
FMEDSDDVSL KNLLKKRKRK VNFTSEGDYQ AAEKEFERLS RLKIKLDSMK QKLTGIQKQR  660
VKDSVEPHSN EPSIIYVPIA VLREKVE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120RRRKKKR
2115120RRKKKR
3116123RKKKRQKN
4609617LKNLLKKRK
5614619KKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543734.10.0PREDICTED: pathogenesis-related homeodomain protein-like
RefseqXP_006593511.10.0PREDICTED: pathogenesis-related homeodomain protein-like
SwissprotP487851e-137PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLA0A151SRV50.0A0A151SRV5_CAJCA; Uncharacterized protein
STRINGGLYMA13G00540.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52753349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.24e-84pathogenesis related homeodomain protein A